diff --git a/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.domains b/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.domains index 5644bbf1..ca4f6d57 100644 --- a/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.domains +++ b/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.domains @@ -1,124 +1,3 @@ -# ----------------------------------------- -# Zelo*s "Threat Intelligence Feeds" -# ----------------------------------------- -# -# Malware, Crypto, Coin, Spam and Pishing -# -# Blocks: -# domains known to spread malware, -# launch phishing attacks and host -# command-and-control servers. -# -# Increases secutity significantly. -# -# It was compiled from numerous sources. -# -# An attempt has been made to avoid false -# positive domains, but still this list -# may contain false positive domains. -# Therefore, an admin should be available -# to allow falsely blocked domains when -# you use this list. -# Please report false positive domains. -# -# It is updated daily and is available in -# the following formats: -# domains, hosts and adblock. -# See: https://github.com/Zelo72 -# -# Created for purely personal, private use. -# Keep the internet clean and safe! -# -# ----------------------------------------- -# Support/Report false positive: -# GitHub: https://github.com/Zelo72 -# Discord: Zelo72#7513 -# Mail: zelo72@dismail.de -# ----------------------------------------- -# -# Nr | Count | Format | Source | Status | File | URL/File -# 1 | 6447 | hosts | http | online | unchanged | https://curben.gitlab.io/malware-filter/phishing-filter-hosts.txt -# 2 | 409 | hosts | http | online | unchanged | https://curben.gitlab.io/malware-filter/pup-filter-hosts.txt -# 3 | 8884 | hosts | http | online | unchanged | https://curben.gitlab.io/malware-filter/urlhaus-filter-hosts.txt -# 4 | 3496 | hosts | http | online | unchanged | https://gitlab.com/ZeroDot1/CoinBlockerLists/raw/master/hosts_browser -# 5 | 33681 | hosts | http | online | changed | https://hole.cert.pl/domains/domains_hosts.txt -# 6 | 550 | hosts | http | online | unchanged | https://paulgb.github.io/BarbBlock/blacklists/hosts-file.txt -# 7 | 5997 | hosts | http | online | unchanged | https://raw.githubusercontent.com/DandelionSprout/adfilt/master/Alternate%20versions%20Anti-Malware%20List/AntiMalwareHosts.txt -# 8 | 2204 | hosts | http | online | unchanged | https://raw.githubusercontent.com/FadeMind/hosts.extras/master/add.Risk/hosts -# 9 | 59 | hosts | http | online | unchanged | https://raw.githubusercontent.com/FadeMind/hosts.extras/master/add.Spam/hosts -# 10 | 44 | hosts | http | online | changed | https://raw.githubusercontent.com/davidonzo/Threat-Intel/master/lists/latestdomains.piHole.txt -# 11 | 1060 | hosts | http | online | changed | https://raw.githubusercontent.com/durablenapkin/scamblocklist/master/hosts.txt -# 12 | 8624 | hosts | http | online | unchanged | https://raw.githubusercontent.com/guardicore/labs_campaigns/master/Autodiscover/autodiscover-tlds.txt -# 13 | 695 | hosts | http | online | unchanged | https://raw.githubusercontent.com/hoshsadiq/adblock-nocoin-list/master/hosts.txt -# 14 | 3686 | hosts | http | online | unchanged | https://raw.githubusercontent.com/infinitytec/blocklists/master/scams-and-phishing.txt -# 15 | 1072 | hosts | http | online | unchanged | https://raw.githubusercontent.com/metamask/eth-phishing-detect/master/src/hosts.txt -# 16 | 1386 | hosts | http | online | unchanged | https://raw.githubusercontent.com/mitchellkrogza/Badd-Boyz-Hosts/master/hosts -# 17 | 13465 | hosts | http | online | unchanged | https://raw.githubusercontent.com/mitchellkrogza/The-Big-List-of-Hacked-Malware-Web-Sites/master/hosts -# 18 | 4432 | hosts | http | online | unchanged | https://threatfox.abuse.ch/downloads/hostfile -# 19 | 883 | adblock | http | online | unchanged | https://raw.githubusercontent.com/piperun/iploggerfilter/master/filterlist -# 20 | 914 | domains | http | online | changed | https://azorult-tracker.net/api/list/domain?format=plain -# 21 | 122584 | domains | http | online | unchanged | https://blocklist.cyberthreatcoalition.org/vetted/domain.txt -# 22 | 549 | domains | http | online | unchanged | https://feeds.alphasoc.net/ryuk.txt -# 23 | 9233 | domains | http | online | unchanged | https://gitlab.com/KevinThomas0/cryptoscamdb-lists/-/raw/master/cryptoscamdb-blocklist.txt -# 24 | 361 | domains | http | online | unchanged | https://gitlab.com/quidsup/notrack-blocklists/raw/master/notrack-malware.txt -# 25 | 33681 | domains | http | online | changed | https://hole.cert.pl/domains/domains.txt -# 26 | 73301 | domains | http | online | changed | https://joewein.net/dl/bl/dom-bl-base.txt -# 27 | 771 | domains | http | online | unchanged | https://joewein.net/dl/bl/dom-bl.txt -# 28 | 1999 | domains | http | online | changed | https://kriskintel.com/feeds/ktip_covid_domains.txt -# 29 | 1997 | domains | http | online | changed | https://kriskintel.com/feeds/ktip_malicious_domains.txt -# 30 | 397 | domains | http | online | unchanged | https://kriskintel.com/feeds/ktip_ransomware_feeds.txt -# 31 | 2245 | domains | http | online | unchanged | https://orca.pet/notonmyshift/domains.txt -# 32 | 44 | domains | http | online | changed | https://osint.digitalside.it/Threat-Intel/lists/latestdomains.txt -# 33 | 44812 | domains | http | online | changed | https://phishing.army/download/phishing_army_blocklist.txt -# 34 | 54454 | domains | http | online | changed | https://phishing.army/download/phishing_army_blocklist_extended.txt -# 35 | 1406 | domains | http | online | unchanged | https://raw.githubusercontent.com/AmnestyTech/investigations/master/2021-07-18_nso/domains.txt -# 36 | 27 | domains | http | online | unchanged | https://raw.githubusercontent.com/DRSDavidSoft/additional-hosts/master/domains/blacklist/fake-domains.txt -# 37 | 35464 | domains | http | online | unchanged | https://raw.githubusercontent.com/PolishFiltersTeam/KADhosts/master/KADomains.txt -# 38 | 675 | domains | http | online | unchanged | https://raw.githubusercontent.com/ShadowWhisperer/BlockLists/master/Lists/Cryptocurrency -# 39 | 22769 | domains | http | online | unchanged | https://raw.githubusercontent.com/ShadowWhisperer/BlockLists/master/Lists/Malware -# 40 | 179 | domains | http | online | unchanged | https://raw.githubusercontent.com/ShadowWhisperer/BlockLists/master/Lists/Risk -# 41 | 3960 | domains | http | online | unchanged | https://raw.githubusercontent.com/bongochong/CombinedPrivacyBlockLists/master/NoFormatting/MD-ID-Fork.txt -# 42 | 18454 | domains | http | online | unchanged | https://raw.githubusercontent.com/cbuijs/shallalist/master/spyware/domains -# 43 | 13908 | domains | http | online | unchanged | https://raw.githubusercontent.com/cbuijs/ut1/master/cryptojacking/domains -# 44 | 169105 | domains | http | online | unchanged | https://raw.githubusercontent.com/cbuijs/ut1/master/malware/domains -# 45 | 434 | domains | http | online | unchanged | https://raw.githubusercontent.com/hpthreatresearch/iocs/main/CryptBot/domains.txt -# 46 | 137 | domains | http | online | unchanged | https://raw.githubusercontent.com/hpthreatresearch/iocs/main/IcedID/domains.txt -# 47 | 644 | domains | http | online | unchanged | https://raw.githubusercontent.com/hpthreatresearch/iocs/main/TA551/domains.txt -# 48 | 3247 | domains | http | online | unchanged | https://raw.githubusercontent.com/iam-py-test/my_filters_001/main/Alternative%20list%20formats/antimalware_domains.txt -# 49 | 2079 | domains | http | online | unchanged | https://raw.githubusercontent.com/matomo-org/referrer-spam-blacklist/master/spammers.txt -# 50 | 71289 | domains | http | online | unchanged | https://raw.githubusercontent.com/mitchellkrogza/Phishing.Database/master/phishing-domains-ACTIVE.txt -# 51 | 318 | domains | http | online | unchanged | https://raw.githubusercontent.com/mitchellkrogza/Phishing.Database/master/phishing-domains-NEW-today.txt -# 52 | 10000 | domains | http | online | unchanged | https://raw.githubusercontent.com/prodaft/malware-ioc/master/FluBot/v3.7_5000_domain.txt -# 53 | 10000 | domains | http | online | unchanged | https://raw.githubusercontent.com/prodaft/malware-ioc/master/FluBot/v3.7_germany.txt -# 54 | 10000 | domains | http | online | unchanged | https://raw.githubusercontent.com/prodaft/malware-ioc/master/FluBot/v3.8_domains.txt -# 55 | 10000 | domains | http | online | unchanged | https://raw.githubusercontent.com/prodaft/malware-ioc/master/FluBot/v3.9_italy.txt -# 56 | 10000 | domains | http | online | unchanged | https://raw.githubusercontent.com/prodaft/malware-ioc/master/FluBot/v4.0_uk.txt -# 57 | 2382 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-amnenstytech.txt -# 58 | 307 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-certego.txt -# 59 | 1010 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-citizenlabs.txt -# 60 | 47 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-cyble.txt -# 61 | 211 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-drweb.txt -# 62 | 158 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-eset.txt -# 63 | 3 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-kaspersky.txt -# 64 | 10592 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-main.txt -# 65 | 1872 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-malware-traffic.txt -# 66 | 2925 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-personal.txt -# 67 | 147 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-sentinelone.txt -# 68 | 512 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-unit42-playbook.txt -# 69 | 23232 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-unit42-silverterrier.txt -# 70 | 3791 | domains | http | online | unchanged | https://raw.githubusercontent.com/scafroglia93/blocklists/master/blocklists-zscaler.txt -# 71 | 150425 | domains | http | online | unchanged | https://raw.githubusercontent.com/stamparm/aux/master/maltrail-malware-domains.txt -# 72 | 16909 | domains | http | online | unchanged | https://raw.githubusercontent.com/stamparm/blackbook/master/blackbook.txt -# 73 | 500 | domains | http | online | unchanged | https://rescure.me/covid.txt -# 74 | 500 | domains | http | online | unchanged | https://rescure.me/rescure_domain_blacklist.txt -# 75 | 77 | domains | http | online | unchanged | https://www.botvrij.eu/data/ioclist.domain.raw -# 76 | 29 | domains | http | online | unchanged | https://www.botvrij.eu/data/ioclist.hostname.raw -# 77 | 35079 | domains | http | online | changed | https://www.stopforumspam.com/downloads/toxic_domains_whole.txt -# 78 | 101660 | domains | http | online | changed | https://www.usom.gov.tr/url-list.txt -# 79 | 29 | domains | local | online | unchanged | black.list.threat-intelligence -# -# 369772 unique Domains - Version 2021.1024.090201 -# 00000000000000000000000000000000000000dfjjjhv.000webhostapp.com 000000000000000000000000000000000000dbscrfg.000webhostapp.com 000000000000000000000000000yteyeuya.000webhostapp.com diff --git a/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.stats b/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.stats index 012bb297..8e3905af 100644 --- a/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.stats +++ b/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.stats @@ -28,13 +28,13 @@ Initialize ... 2 | 409 | hosts | http | online | unchanged | https://curben.gitlab.io/malware-filter/pup-filter-hosts.txt 3 | 8884 | hosts | http | online | unchanged | https://curben.gitlab.io/malware-filter/urlhaus-filter-hosts.txt 4 | 3496 | hosts | http | online | unchanged | https://gitlab.com/ZeroDot1/CoinBlockerLists/raw/master/hosts_browser - 5 | 33681 | hosts | http | online | changed | https://hole.cert.pl/domains/domains_hosts.txt + 5 | 33681 | hosts | http | online | unchanged | https://hole.cert.pl/domains/domains_hosts.txt 6 | 550 | hosts | http | online | unchanged | https://paulgb.github.io/BarbBlock/blacklists/hosts-file.txt 7 | 5997 | hosts | http | online | unchanged | https://raw.githubusercontent.com/DandelionSprout/adfilt/master/Alternate%20versions%20Anti-Malware%20List/AntiMalwareHosts.txt 8 | 2204 | hosts | http | online | unchanged | https://raw.githubusercontent.com/FadeMind/hosts.extras/master/add.Risk/hosts 9 | 59 | hosts | http | online | unchanged | https://raw.githubusercontent.com/FadeMind/hosts.extras/master/add.Spam/hosts - 10 | 44 | hosts | http | online | changed | https://raw.githubusercontent.com/davidonzo/Threat-Intel/master/lists/latestdomains.piHole.txt - 11 | 1060 | hosts | http | online | changed | https://raw.githubusercontent.com/durablenapkin/scamblocklist/master/hosts.txt + 10 | 44 | hosts | http | online | unchanged | https://raw.githubusercontent.com/davidonzo/Threat-Intel/master/lists/latestdomains.piHole.txt + 11 | 1060 | hosts | http | online | unchanged | https://raw.githubusercontent.com/durablenapkin/scamblocklist/master/hosts.txt 12 | 8624 | hosts | http | online | unchanged | https://raw.githubusercontent.com/guardicore/labs_campaigns/master/Autodiscover/autodiscover-tlds.txt 13 | 695 | hosts | http | online | unchanged | https://raw.githubusercontent.com/hoshsadiq/adblock-nocoin-list/master/hosts.txt 14 | 3686 | hosts | http | online | unchanged | https://raw.githubusercontent.com/infinitytec/blocklists/master/scams-and-phishing.txt @@ -48,16 +48,16 @@ Initialize ... 22 | 549 | domains | http | online | unchanged | https://feeds.alphasoc.net/ryuk.txt 23 | 9233 | domains | http | online | unchanged | https://gitlab.com/KevinThomas0/cryptoscamdb-lists/-/raw/master/cryptoscamdb-blocklist.txt 24 | 361 | domains | http | online | unchanged | https://gitlab.com/quidsup/notrack-blocklists/raw/master/notrack-malware.txt - 25 | 33681 | domains | http | online | changed | https://hole.cert.pl/domains/domains.txt - 26 | 73301 | domains | http | online | changed | https://joewein.net/dl/bl/dom-bl-base.txt + 25 | 33681 | domains | http | online | unchanged | https://hole.cert.pl/domains/domains.txt + 26 | 73301 | domains | http | online | unchanged | https://joewein.net/dl/bl/dom-bl-base.txt 27 | 771 | domains | http | online | unchanged | https://joewein.net/dl/bl/dom-bl.txt - 28 | 1999 | domains | http | online | changed | https://kriskintel.com/feeds/ktip_covid_domains.txt - 29 | 1997 | domains | http | online | changed | https://kriskintel.com/feeds/ktip_malicious_domains.txt + 28 | 1999 | domains | http | online | unchanged | https://kriskintel.com/feeds/ktip_covid_domains.txt + 29 | 1997 | domains | http | online | unchanged | https://kriskintel.com/feeds/ktip_malicious_domains.txt 30 | 397 | domains | http | online | unchanged | https://kriskintel.com/feeds/ktip_ransomware_feeds.txt 31 | 2245 | domains | http | online | unchanged | https://orca.pet/notonmyshift/domains.txt - 32 | 44 | domains | http | online | changed | https://osint.digitalside.it/Threat-Intel/lists/latestdomains.txt - 33 | 44812 | domains | http | online | changed | https://phishing.army/download/phishing_army_blocklist.txt - 34 | 54454 | domains | http | online | changed | https://phishing.army/download/phishing_army_blocklist_extended.txt + 32 | 44 | domains | http | online | unchanged | https://osint.digitalside.it/Threat-Intel/lists/latestdomains.txt + 33 | 44812 | domains | http | online | unchanged | https://phishing.army/download/phishing_army_blocklist.txt + 34 | 54454 | domains | http | online | unchanged | https://phishing.army/download/phishing_army_blocklist_extended.txt 35 | 1406 | domains | http | online | unchanged | https://raw.githubusercontent.com/AmnestyTech/investigations/master/2021-07-18_nso/domains.txt 36 | 27 | domains | http | online | unchanged | https://raw.githubusercontent.com/DRSDavidSoft/additional-hosts/master/domains/blacklist/fake-domains.txt 37 | 35464 | domains | http | online | unchanged | https://raw.githubusercontent.com/PolishFiltersTeam/KADhosts/master/KADomains.txt @@ -100,8 +100,8 @@ Initialize ... 74 | 500 | domains | http | online | unchanged | https://rescure.me/rescure_domain_blacklist.txt 75 | 77 | domains | http | online | unchanged | https://www.botvrij.eu/data/ioclist.domain.raw 76 | 29 | domains | http | online | unchanged | https://www.botvrij.eu/data/ioclist.hostname.raw - 77 | 35079 | domains | http | online | changed | https://www.stopforumspam.com/downloads/toxic_domains_whole.txt - 78 | 101660 | domains | http | online | changed | https://www.usom.gov.tr/url-list.txt + 77 | 35079 | domains | http | online | unchanged | https://www.stopforumspam.com/downloads/toxic_domains_whole.txt + 78 | 101660 | domains | http | online | unchanged | https://www.usom.gov.tr/url-list.txt 79 | 29 | domains | local | online | unchanged | black.list.threat-intelligence # Build threat-intelligence Domainlist ... @@ -114,41 +114,7 @@ Stats threat-intelligence: -- White(*): 860084 (-1648) -- Dead: 369772 (-490312) -369772 unique Domains - Version 2021.1024.090201 -MD5 Domains RAW: 1e2436b44c8ccffebd55c91b4a963f6d - -# Convert threat-intelligence to Hostlist ... - -# Convert threat-intelligence to AdBlocklist ... - -Prepare domain list for compiling ... done. - -ℹ Starting @adguard/hostlist-compiler v1.0.12 -ℹ Starting the compiler -ℹ Configuration: { - "name": "threat-intelligence", - "sources": [ - { - "source": "threat-intelligence.adblock.raw", - "type": "adblock", - "transformations": [ - "Validate" - ] - } - ], - "transformations": [ - "Compress" - ] -} -ℹ Start compiling threat-intelligence.adblock.raw -ℹ Original length is 349529 -ℹ Length after applying transformations is 349529 -ℹ The list was compressed from 349532 to 321255 -ℹ Final length of the list is 321261 -ℹ Writing output to /media/nas/git/rpi/pihole/blocklists/build/threat-intelligence/out/threat-intelligence.adblock -ℹ Finished compiling - -# Attach header to threat-intelligence Domainlist ... - -# Push threat-intelligence to local Repositories ... +***************************************************** +* No changes to the previous repo version detected! * +***************************************************** diff --git a/pihole/blocklists/sources/azorult-tracker.net_api_list.txt b/pihole/blocklists/sources/azorult-tracker.net_api_list.txt index 3af75cac..276a74e0 100644 --- a/pihole/blocklists/sources/azorult-tracker.net_api_list.txt +++ b/pihole/blocklists/sources/azorult-tracker.net_api_list.txt @@ -86,8 +86,8 @@ narkoman1337.000webhostapp.com akinseltv.com azor.myjino.ru aurumboy.com -seth-nick.duckdns.org emdholdings.co.za +seth-nick.duckdns.org inboxindexwin.kebapkokorec.com tillivilli.website ha4cker.000webhostapp.com @@ -158,8 +158,8 @@ purifckd.ug rulletedonut.000webhostapp.com ipmedia.info standartjuke.info -ntrcgroup.com f0386817.xsph.ru +ntrcgroup.com uploadsnew.site grabberweter.000webhostapp.com cxvbdsfgxvc.ug @@ -241,8 +241,8 @@ jdjjegellowd.duckdns.org pnumbrero3.ru yuioph.beget.tech mixfighte2.temp.swtest.ru -xexex.duckdns.org mnjkoug.ug +xexex.duckdns.org rrgodshsf.ug mmuell.com scogcs.000webhostapp.com @@ -350,8 +350,8 @@ pysik.club naralupd.000webhostapp.com strtesr4.beget.tech jerichoconstructioncompany.com -j3493273.myjino.ru bengalcement.com.bd +j3493273.myjino.ru alvaros.beget.tech exportersgateway.com newworld.zzz.com.ua @@ -444,10 +444,10 @@ bopheloclub.org sylvaclouds.eu a0386457.xsph.ru romasshved41.000webhostapp.com -fullelectronica.com.ar -webpanell.website nazarvitalik.000webhostapp.com +webpanell.website a0458390.xsph.ru +fullelectronica.com.ar rewrty-71.tk uvayuov.hussanways.com vjhscvbncv.ru @@ -469,9 +469,9 @@ jlckey.000webhostapp.com jzvhzmu.duckdns.org emda-2.duckdns.org xn----7sbak5bugi.xn--p1ai -f0371887.xsph.ru smartlinktelecom.top pom4ekoffi.temp.swtest.ru +f0371887.xsph.ru purity.monster trepeth3.beget.tech darkface.ac.ug @@ -515,9 +515,9 @@ aduni273.duckdns.org dubeysurya2468.xyz jacob228.tmweb.ru medireab.ga -addaxgs.com absorbent-spokes.000webhostapp.com av4.website +addaxgs.com 656ttyghhg.hopto.org betprognoz.pro georna234.beget.tech @@ -551,8 +551,8 @@ themindset.org.ng ltctradings.com k90177j3.beget.tech f0390547.xsph.ru -l2c9b1d0.justinstalledpanel.com ignatsuhac.temp.swtest.ru +l2c9b1d0.justinstalledpanel.com weilde.at dyslexic-picture.000webhostapp.com bestlogs.myjino.ru @@ -612,16 +612,16 @@ j1041445.myjino.ru russellipm-storedproductsinsects.com citysammy.casacam.net auxinity.000webhostapp.com +stodfm34.ug vovagaka.myjino.ru vitya01.xyz -stodfm34.ug yandibiotech.com.vn aca1cab2452.duckdns.org sber-host.000webhostapp.com cheap9xxxx.beget.tech j1034033.myjino.ru -warungpencar.com luminatebase.000webhostapp.com +warungpencar.com drossmnfg.com ghost250960.worldhosts.ru alexkraskrasnov.myjino.ru @@ -734,9 +734,9 @@ f0401036.xsph.ru a0395941.xsph.ru sinkable-ingredient.000webhostapp.com yoflccv.ug -2e78f.duckdns.org -cntrol.duckdns.org xcvfghfds.ug +cntrol.duckdns.org +2e78f.duckdns.org tradefair.duckdns.org ziggeroff.000webhostapp.com access098.duckdns.org @@ -822,8 +822,8 @@ martinicos.had.su snowagainfearfreezesagainagainitfeelslikeiceisinmyhands.space f0387181.xsph.ru khaliddib398.xyz -deviceful-errors.000webhostapp.com gamervordl.000webhostapp.com +deviceful-errors.000webhostapp.com cy62976.tmweb.ru verifycrash.mcdir.ru gta-fast.pro @@ -838,8 +838,8 @@ f0371188.xsph.ru killersam.beget.tech nikitaakimenkoklass.000webhostapp.com u0929560.cp.regruhosting.ru -sharjoff.000webhostapp.com f0409474.xsph.ru +sharjoff.000webhostapp.com olgaa.ir pinlateofficial.xyz h839492.duckdns.org @@ -885,13 +885,13 @@ topik07.mcdir.ru aboutworld.info afamedya.com www.kahtamarkalar.com -777hustle777.info levitts.ug onlinecheck.hussanways.com tarot-sunce.com httpcenter.duckdns.org browserplugin.duckdns.org 634f4f9v1.duckdns.org +777hustle777.info furrer.000webhostapp.com menylead.xyz f0400620.xsph.ru